PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022998851.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 826aa    MW: 91532.1 Da    PI: 6.481
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022998851.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-096236601954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  XP_022998851.1 623 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 660
                     564459******************************87 PP

2BELL114.94.1e-37480548472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e q+kkakLl +leeV++rYkqy++q+q+v+ssFe vagl sa+pY+slAlk++SrhFrcLk+ai+eq+
  XP_022998851.1 480 EYQQKKAKLLYILEEVCRRYKQYHQQMQMVVSSFESVAGLSSATPYISLALKTVSRHFRCLKNAISEQL 548
                     88*****************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    
MEHCYGFEQH VAQQSRRDKL RVPQNYLRVV GELSSNSGEQ LGFQNSEHSG LDLDLVRIQS  60
FNKNAILPHD LSSFPAEMIN FSRDSNVLSD QRHIMLRQEP EDPGQCSRQI LADASLGSFA  120
NSLLKASGEI MNNSLGDWVV NCGSNSLGGE MLNEEVTDST VYSLKPTCIG FQTSTSFNNP  180
SNETFIQDGQ KRIAGELHLP PIYQNSLQGV TSASIGTQDM EMTSIVQHNF TEINQTGSCE  240
GSGNELALLP VYRDQPNVLP YDSTGSWTDR TFYNCRSWTG DLGSIARKTG EELRTFMSDS  300
NPQGLSLSLS SNPPSKLPTA QFEESEELQE NMTVLKNPQE SKAGKSENFC RLPNPTSIGN  360
KNHGKSLQDA MGAPMNTYRN TGPLGPFTGY ATILKSSKFL KPAQLLLDEF FGSNGQKFVQ  420
PYEVFEKTSG EVGASAVHSA FRNEVVKENS SCAEASTFCG SNETNVSGVG SISTEPHQPE  480
YQQKKAKLLY ILEEVCRRYK QYHQQMQMVV SSFESVAGLS SATPYISLAL KTVSRHFRCL  540
KNAISEQLKY LRKVLGEDLS SPSAGTSGSK GDANSARLKY MEQSFQKQKS GMVNMGFLES  600
QHVWRPQRGL PERAVAILRA WLFEHFLHPY PTDTDKHMLA TQTGLSRNQV SNWFINARVR  660
VWKPMVEEIH MLETKGMAEM NNKSHGTKDG SSTIENTAGW ISSEQQPLKN HGVANEIASH  720
HLQCLGVDSS SGDRNGVGSS NQQCDQDKQS KLDQGIQSNM EGELMGFMPY RARPAEVGGL  780
GSVSLTLGLH HRVESAHHQQ QHHQMQQQDD QLIRHYGGQM VHDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.14e-87TALE family protein