PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022996948.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 385aa    MW: 43556.4 Da    PI: 6.9106
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022996948.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-093043401955
                     HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_022996948.1 304 HNKWPYPSEAEKLALAESTGLDQKQINNWFINQRKRH 340
                     34679*****************************885 PP

2ELK35.91.6e-12260281122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++Ll+KYsgyL+sLkqE+s
  XP_022996948.1 260 ELKNHLLKKYSGYLSSLKQELS 281
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    
MEDQYNPHGD RSRGNFLFTS VPVLATNSSS PGGNFVTRPS SSNGGGASIV GNQIMAVNTN  60
LGGDCNFPAS DRFVKVEPSG SQSQNHHHHH QVHDFHYHLM REFQISRGGN NSNDLDSMKA  120
KIISHSLFSN LLQAFLDCQK VGAPPEVAAK LSSVGEEFEQ RRRSSTASTG GSTDPELDHF  180
MEAYYGMLVK YREELTRPIR EAADFMHRIE FQLNTLCNAS FQILASATEE KGWSEEEQEK  240
SREAEREVGD QMDPRAEERE LKNHLLKKYS GYLSSLKQEL SKKKKKGKLP KDARQELLRW  300
WELHNKWPYP SEAEKLALAE STGLDQKQIN NWFINQRKRH WKPSEDAQFM GMEGFYHPNA  360
AAAAAAAAFY FDGHFMGDSH YRLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-91TALE family protein