PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022996947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 386aa    MW: 43627.5 Da    PI: 6.9106
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022996947.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-093053411955
                     HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_022996947.1 305 HNKWPYPSEAEKLALAESTGLDQKQINNWFINQRKRH 341
                     34679*****************************885 PP

2ELK35.91.6e-12261282122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++Ll+KYsgyL+sLkqE+s
  XP_022996947.1 261 ELKNHLLKKYSGYLSSLKQELS 282
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    
MEDQYNPHGD RSRGNFLFTS VPVLATNSSS PGGNFVTRPS SSNGGGASIV GNQIMAVNTN  60
LGGDCNFPAS DRFVKVEPSG SQSQNHHHHH QVHDFHYHLM REFQISRGGN NSNDLDSMKA  120
KIISHSLFSN LLQAFLDCQK VGAPPEVAAK LSSVGEEFEQ RRRSSTASTG GSTDPELDHF  180
MEAYYGMLVK YREELTRPIR EAADFMHRIE FQLNTLCNAS FQILASAATE EKGWSEEEQE  240
KSREAEREVG DQMDPRAEER ELKNHLLKKY SGYLSSLKQE LSKKKKKGKL PKDARQELLR  300
WWELHNKWPY PSEAEKLALA ESTGLDQKQI NNWFINQRKR HWKPSEDAQF MGMEGFYHPN  360
AAAAAAAAAF YFDGHFMGDS HYRLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.13e-91TALE family protein