PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022996615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 464aa    MW: 51385.5 Da    PI: 5.6286
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022996615.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.42.1e-074024342254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_022996615.1 402 WPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 434
                     69*****************************87 PP

2ELK26.31.7e-09355376122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y++++ ++++E++
  XP_022996615.1 355 ELKHELKNGYKEKILDIREEIL 376
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    
MAFRNQLSQD LPLHYENQSQ PERPLSANTL RSILSDQLTD HSQADDGSKP EHPLQSTPNW  60
LNSALLRNQA PHSHFSDETT ATAADNVDTD FLNLHTTAAN SAVSHPSGQW LSRAILHRDH  120
SDVLDEVADA ADAMIGATTL SRESDDLKNN SSGGGGEGAN NSDDVAVESD GNEGAYGGDA  180
VMNWQNARFK AEILAHPLYE QLLSAHVACL RIATPVDQLP RVDSQLARSQ NVAAKYSSFG  240
HRSQPIAGNG KELDQFMTHY VLLLCSFKEQ LQQHVRVHAM EAVYACWEIE QSLQSLTGVS  300
PGEGTGATMS DDDEDQTDSD ANLFDGSFEG HDAMGFGPLI PTDSERSLME RVRHELKHEL  360
KNGYKEKILD IREEILRKRR AGKLPGGTTS VLKAWWQSHS NWPYPTEEDK AKLVQETGLQ  420
LKQINNWFIN QRKRNWHTNP STSTTLKTKR KRSNAGEATG NNHP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1432452RKRNWHTNPSTSTTLKTKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-161TALE family protein