PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022996525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 473aa    MW: 53391.1 Da    PI: 6.287
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022996525.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.4e-084164541854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  XP_022996525.1 416 MFQNflHPYPKDTEKHLLAVKSGLTRNQVSNWFINARVR 454
                     6887779******************************88 PP

2BELL63.54.4e-21292355670
            BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiae 70 
                      +kk++Ll+ll+ +d+rY+q+ ++++tv s+F+a+++l++ +++t+  l++i+  +++L+++i++
  XP_022996525.1 292 DAKKSHLLTLLQLIDERYSQCLDEIHTVTSAFHAATDLDP-RLHTRYTLQTITSVYKNLREKITD 355
                     58**************************************.**********************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    
MSTALQQIDL GDACSSPSGN AELHNQLAGA IPVNFFQSTS LTPVNVVCEN TKDIAFPDRH  60
FQPLETFRTC IIPSTSNALN SSFASSLICE DDESLCNLNK WENQRFNCIQ QLARENPERS  120
DFQTISSMEN LNQNGWMPSN TMNSKLWNEL SLSLATSNPV LSGGTNFLDQ YSQLTFSGAT  180
QPCLNSTELA SNLNSCNFRD LSLSYRCGSP VHLSQAIAGS RYLSVIQDVL SQIASYPLES  240
SEQDRHLTST VGFVPFSSSS LDDNTVEFGS DITGRCSSQI QMELQWQKLS GDAKKSHLLT  300
LLQLIDERYS QCLDEIHTVT SAFHAATDLD PRLHTRYTLQ TITSVYKNLR EKITDCIIAV  360
GMHSDTMCTK ENEKTFEASF IQKQWALQQL KRKDSQLWRP QRGLPEKSVS VLRAWMFQNF  420
LHPYPKDTEK HLLAVKSGLT RNQVSNWFIN ARVRLWKPMI EEMYAEMSRR KSS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-101TALE family protein