PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022995883.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 301aa    MW: 33667.9 Da    PI: 6.5108
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022995883.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.9e-082502832154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_022995883.1 250 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 283
                     469*****************************87 PP

2ELK25.53.2e-09204225122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_022995883.1 204 ELKIELKQGFKSRIEDVREEIL 225
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    
MQEPGLGVMT AAAAAAASTA ALSGDVSISG DNAQLKAEIA THPLYEQLLA AHVACLRVAT  60
PIDQLPIIDA QLAQSHHVLR SYASQQHHQH AHSLSPHDRQ ELDNFLAQYM IVLCSFKDQL  120
QQHVRVHAVE AVMACREIEN TLQALTGVSL GEGSGATMSD DDDDDVPIEF SLDQSGGDAH  180
DMMGFGPLLP TESERSLMER VRQELKIELK QGFKSRIEDV REEILRKRRA GKLPGDTTTV  240
LKNWWQQHSK WPYPTEDDKA KLVEETGLQL KQINNWFINQ RKRNWHSNSQ SVTSLKSKRK  300
R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281301RKRNWHSNSQSVTSLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-164TALE family protein