PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022995544.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 567aa    MW: 63623.9 Da    PI: 5.8236
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022995544.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.2e-093523891954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_022995544.1 352 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 389
                     554459******************************88 PP

2BELL113.41.3e-36214284272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +++lq++k+kL s+leeV++rY++y+eq+++v++sFeavag g+a++Y +lA+ka+SrhFrcLkd i++qi
  XP_022995544.1 214 FMDLQRRKTKLFSMLEEVERRYRHYCEQMKAVVASFEAVAGSGAARVYSALASKAMSRHFRCLKDGIVGQI 284
                     689******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    
MARELCEGEE KPNEMVVGGG GFYYNSNSNL NIQTQFTSQI QTGFGSGGDT AEMFNLGTNE  60
STGGDEFHQN MMVVGPWGTA AQDSNNRFHL VDDDSALRCV FPCEPNERPS QGLSLSLSSS  120
NPSSIGLQSF ELRPQQNQHQ SSSLPIFQLR NSRFLAPAQD LLYEFCSLGI TINNNNKQGL  180
DFSSSPKHKG NRPKQWEMED GSSSTKISLQ SLDFMDLQRR KTKLFSMLEE VERRYRHYCE  240
QMKAVVASFE AVAGSGAARV YSALASKAMS RHFRCLKDGI VGQIQATKKA IEEKDPITPG  300
TTRGETPRLK VIDQALRQQR AFHQISMMES HPWRPQRGLP ERSVSVLRAW LFEHFLHPYP  360
SDVDKHILAR QTGLSRSQVS NWFINARVRL WKPMVEEMYL EETKEQGEEI NNNFNGHSSD  420
GVADFDDEID GHRLIPTRLV DQKPTPDQLL RIESECMSSI ISNNSEKNGS RSMRAMENQS  480
FGRVGADAFG TVELDFSSYN HHHSSSGGGG VSLTLGLQQH ATQSSVFFRS DEMEECEPVQ  540
YSLLDGETQN LPYRNLMGAQ LLHDLAE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-127TALE family protein