PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022995041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 619aa    MW: 68105.2 Da    PI: 7.6109
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022995041.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.44.2e-073924242254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++y + +++  LAk++gLt +qV++WF N R +
  XP_022995041.1 392 HPYRKDSDKIILAKQTGLTRSQVSNWFINARVR 424
                     56667777888********************88 PP

2BELL111.93.7e-36251322172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rq+lq+kkakL+ +l+eV+++Y+qy++q+q+v+ sFe++agl+sak Y+slAl++iS++FrcLkdai+ q+
  XP_022995041.1 251 QRQDLQMKKAKLIGMLDEVEQKYRQYHQQMQAVACSFEQAAGLDSAKCYASLALQTISKQFRCLKDAICAQV 322
                     699*******************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    
MATYFHGGSE IQASSDGIHT LYLMNPNYVP YSDTHSQTPP NMLFLNPSTH ALTPSTLPHA  60
PPSTNHFVGI PLPATDTSRP TYHEISALHS VPAQRLHYNL WAPMDQISSV SAATDPTDLS  120
FRRPGTHQGL SLSLSSQQSL YRTMSADQEI QGGRGGGAPD ISPTSGDEIR VSGNSPASAS  180
VSVVSSGVAG SKYLKAAQEL LDEVVNVGKG NKTDKGDKMK MKKESTAAIA EPSGGGAEST  240
SKPVTELTTA QRQDLQMKKA KLIGMLDEVE QKYRQYHQQM QAVACSFEQA AGLDSAKCYA  300
SLALQTISKQ FRCLKDAICA QVKASGKSLG EEDWSGGKIE GSRLRYVDHH VRQQRALQQL  360
GMIQHNTWRP QRGLPERAVS VLRAWLFEHF LHPYRKDSDK IILAKQTGLT RSQVSNWFIN  420
ARVRLWKPMV EEMYSEEIKE QEQNSDSHDM NRHNKNEPNK QNHQIMNDSL NDQVSNSLQA  480
HSGFNLVRPS SDMLSCPKRQ RTTNNLETLS TKSTLSKDIN DTKHVHGGGF GSYPIHEIGS  540
RFNSELLTPR FHANGVSLTL GLPQTYLSDP NLQLGTRVDI TNGGSDFTDI DPAPATAYDG  600
VEIQTTKRFA AQLLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-122TALE family protein