PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022991691.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 518aa    MW: 58051.3 Da    PI: 6.2019
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022991691.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-093513881954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+ +L++++gLt +qV +WF N R +
  XP_022991691.1 351 FEHflHPYPKDSEKLKLSRQTGLTRNQVANWFINARVR 388
                     664459******************************88 PP

2BELL87.51.4e-28215286172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erq+l++k +kLlsll eVd+rYkqy+e lq +  sF++v+g g+a+ Yt+lA ++iS hFr ++dai  qi
  XP_022991691.1 215 ERQDLKNKNSKLLSLLGEVDRRYKQYYEHLQLLSLSFDMVTGRGAAEFYTALAHQTISCHFRRMQDAINAQI 286
                     799******************************************************************998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    
MLGDDQKLGC SSQEQPLCSG NLMMFMKNQD PSCRDYSEVF SGVSSNYVES VGDRSNGEMI  60
FIPPVVGILD NPNFQCQGVS LSLSTHSPSV VSMSSFPHQY QTPAMASPFI NASPSIFEKR  120
PNPKPYNGMH IAAGSGNSTL NLVYVKAAQQ VLDEMVSIRE ALKELKSRKL KGSSGLGVDF  180
CRENDGGCND VNGEICSGSR ELSIVNSLGD LSPTERQDLK NKNSKLLSLL GEVDRRYKQY  240
YEHLQLLSLS FDMVTGRGAA EFYTALAHQT ISCHFRRMQD AINAQIEVTR RTLGEQDASH  300
FVQEGIPRLR FVDQHLRQQR ALQQLGVTPH SWRPQRGLPE SSVSILRAWL FEHFLHPYPK  360
DSEKLKLSRQ TGLTRNQVAN WFINARVRLW KPMVEEMYKE EFGDSDIKSS PENASKASWN  420
NSLFSEDRGG DELHEQVLYR SCSTDDMIKS TNFSVGGDVS LALELKHCEG DEFGMFGSST  480
NRMVGSVELE AQDLPCLEPE RHHQCRLTSS NMLHDFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.23e-88TALE family protein