PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022988875.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 286aa    MW: 32946.4 Da    PI: 6.8538
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022988875.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.2e-092142482155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+ +q+ +WF N+R ++
  XP_022988875.1 214 KWPYPSESQKVALAESTGLDLKQINNWFINQRKRH 248
                     569*****************************885 PP

2ELK39.89.7e-14168189122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_022988875.1 168 ELKGQLLRKYSGYLGSLKQEFL 189
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    
MDRGLIMFDH NNNNDSDSNN KKMFLPYNDH VQTCRAKLMA HPLFPRLLAS YVNCQKVGAP  60
PDVVARLEQA CTVAAGNCRT VARGDDPGLD QFMEAYCEML SKYEQELTKP FKEAMVFFSR  120
IESQLKALAA SSSSSDGYEL VGQNECSKEI EVVDMNENYI DPQAEEKELK GQLLRKYSGY  180
LGSLKQEFLK KKKNGKLPKE ARQQLLDWWS RHYKWPYPSE SQKVALAEST GLDLKQINNW  240
FINQRKRHWK PSEDMQFVVM DAAHPHYYLD NLICNPFSMD CSSTLF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-112TALE family protein