PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022986470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 678aa    MW: 74156.1 Da    PI: 5.616
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022986470.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-094184551954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_022986470.1 418 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 455
                     664559******************************88 PP

2BELL124.54.1e-40280351172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+q+lq+k +kLl +l+eVd+rY+qy++q+q+v+ssF+++ag+g++kpYt+lAl++iSrhFrcL+daia+q+
  XP_022986470.1 280 EKQDLQNKLTKLLYMLDEVDRRYNQYYHQMQIVVSSFDVIAGCGASKPYTALALQTISRHFRCLRDAIADQV 351
                     6899******************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    
MATYYSSSNN ERDTTPILYS RGALLGSYEE TAVLPRNMMM NANSGTFMDS LPSPAQNGCS  60
SITPVGAVGM TQQQQEFLSN LGGSQISDHD FNTWREDRSE MLGTNSMCGS TNVLRGGQNL  120
QGQGLSLTLS TQIPSGIQMA SIPYRDSDVS LASFLRPNPT SSSEDGCRNG ASRDEQLRNG  180
ENLAKGELSP YSMSSIARTM PNSKYLKAAQ QLLDEVVNVR KALKRPNNER DPSSNEHETG  240
TAENGDAGAK NDTSMQTASG ASSKPQETGS NSTCELSHGE KQDLQNKLTK LLYMLDEVDR  300
RYNQYYHQMQ IVVSSFDVIA GCGASKPYTA LALQTISRHF RCLRDAIADQ VRATRKSLGE  360
HENSGNDKGV GITRLRYVDQ QLRQQRALQQ LGMIQQHAWR PQRGLPENSV SILRAWLFEH  420
FLHPYPKDSD KIMLARQTGL TRSQVSNWFI NARVRLWKPM VEEMYKEEIG SVDMDSISSS  480
ENASKATKGD NKTFEDDKEE DLQQSASSTA TERCSAGDIV DLKSDLSNLA NSGSNRLASC  540
QNGSHIEAEN ELIKPNEELR SNENNSNFFP DAIVQSQGES DRFMAAAAAA YHMSELGRFG  600
TVGGVSLTLG LQHCEGGGGI PMPAGTHHGF AAMRGDDMYN AAAAASSLGE TVHFECVNAA  660
GNPQLRFGPS HLYHDFVV
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-115TALE family protein