PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022985779.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 667aa    MW: 73268.8 Da    PI: 8.1324
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022985779.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.65.1e-094054421954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_022985779.1 405 FEHflHPYPKDSDKIILAKQTGLTRSQVSNWFINARVR 442
                     554459******************************88 PP

2BELL112.32.7e-36269340172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rq+lq+kkakL+ +l+eV+++Y+qy++q+q+v++ Fe++aglgsak+Y+slAl +iS++FrcLkdai+ qi
  XP_022985779.1 269 QRQDLQMKKAKLIGMLDEVEQKYRQYHQQMQAVVNCFEQAAGLGSAKSYASLALETISKQFRCLKDAICAQI 340
                     699********************************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    
MATYFHGGSE IQANSDGTHT LYLMNPNYVP YSDTHSQTPP SMLFLNPSGH AHNPSTLPHA  60
PPSNNHFVGI PLSTTDAPRP SYASQSAHEI SALHPMPSQR LHYNLWAPMD QQTHHGISTV  120
SATTDSTDLC FRRPTTQQGL SLSLSSQQSL YRTLSAEQEI QGGGGAPAIS PTSGDDIRVS  180
GNSPTSVSVV SSGITGVQSV ILGSKYLKAA QELLDEVVNV GKGNYKTDKG DGTKDKMKMK  240
KESTAAIGGA PSGGGETTSK PAAELSTAQR QDLQMKKAKL IGMLDEVEQK YRQYHQQMQA  300
VVNCFEQAAG LGSAKSYASL ALETISKQFR CLKDAICAQI KATGKSLGEE DWLGAKIEGS  360
RLRYVDHHLR QQRALQQLGM IQHNTWRPQR GLPERAVSVL RAWLFEHFLH PYPKDSDKII  420
LAKQTGLTRS QVSNWFINAR VRLWKPMVEE MYLEEIKEQE QNGDSHDMLR TNKNEPNKQH  480
GRGGGDQNNN NNIKDDPAQS KTENLMNNQN NIHANPKKQR TTTAANNNLE TPSTKTMLLR  540
DIDTTKHLLQ TTAEMNMNHH HYHGGGGGFG AYPVGEIGTR FNSELLTPRF HGNGVSLTLG  600
LPHSDTQHNY HLGRRLDITN GGGPDFSDIN PTPPPPPPPH SASTAYDHVE MQTTKRFAAQ  660
LLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-116TALE family protein