PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022982729.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 499aa    MW: 55827.6 Da    PI: 7.2295
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022982729.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-092933301954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LAk++gL+ +qV++WF N R +
  XP_022982729.1 293 FEHflHPYPSDTDKLMLAKQTGLSRSQVSNWFINARVR 330
                     554459******************************88 PP

2BELL80.52.2e-26184247972
            BELL   9 kakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     k+ Lls+l+e++++Ykqy++q+q v+ sFe + glg+a+pY++ A k + +hF+cLk+ai +q+
  XP_022982729.1 184 KSTLLSMLDEIYRKYKQYYQQVQEVMTSFEYISGLGNAAPYANQAIKVMYKHFKCLKNAILDQL 247
                     789**********************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    
MAEGIESFDH VPQQSRRDKL REHSDHRSTF LPFYDDPSSL ISPPSDSTHR FQFHHHPFFD  60
PQIQSSLLPD IHQQNHCFTS EPLSLSLSSQ PFLAAPIPPA LPLGPFTGYA SILKGSRFLK  120
PAHQLLEELC DVVGLHPAFP SSSSLNSPPS PSPSPSAFMD DPSSDSPILD HHPLASSHSA  180
PPIKSTLLSM LDEIYRKYKQ YYQQVQEVMT SFEYISGLGN AAPYANQAIK VMYKHFKCLK  240
NAILDQLQFN KKTRGDYSQR SGQNPGFLDH QPVWRPQRGL PERAVTVLRA WLFEHFLHPY  300
PSDTDKLMLA KQTGLSRSQV SNWFINARVR LWKPMVEEIY MLETKQTQKN LHRDDRDPCN  360
RLNDHHPTNL LAIDNPSKST QEIQDTPTKR TRNKLHDVPM GDNDEPLNVS YNVSSHPHVG  420
SNANMGGNNN GVSLTLGLHQ NNNNNGIGGG FSEPFPVGFP VAATRRFGLG IQGNSDGYVM  480
GGHFGRDVVG GQLLHDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-77TALE family protein