PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022982378.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 366aa    MW: 41776.5 Da    PI: 5.8846
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022982378.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-092933282055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_022982378.1 293 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 328
                     5679*****************************885 PP

2ELK31.15.1e-11248269122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsg L+sLkqE+s
  XP_022982378.1 248 ELKNHLLRKYSGFLSSLKQELS 269
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    
MEDYNNHLNE NSNPRGNFLY ASSNSSSGNY GRSSNPTAQM AAHTFHLQQG ADCFQADQSH  60
PIVKSEASTS HHQLLKFHYP LGQPPPPTTT TTCRPDDDGG VDVEDIKAKI VAHPQYSSLL  120
EAYMECQKVG APPQVVEQLV AARQEFEARQ RSSMVSGDST KDPELDQFME AYYDMLVKYR  180
EELTRPVQEA MDFMRRIESQ LSSLCNGPVR IFNSDEKCEG IGSSEEEQEN SGGETELPEI  240
DPRAEDRELK NHLLRKYSGF LSSLKQELSK KKKKGKLPKD ARQKLLNWWE LHYKWPYPSE  300
TEKVALAEST GLDQKQINNW FINQRKRHWK PSEDMQFMVM DGLHPSNAAL YLDGHYMTDG  360
HYRLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-130TALE family protein