PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022981202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 446aa    MW: 49519 Da    PI: 6.5077
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022981202.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.4e-073834162154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_022981202.1 383 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 416
                     469*****************************87 PP

2ELK22.42.8e-08337358122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+ +Y+++++++++E++
  XP_022981202.1 337 ELKHELKAGYKEKIVDIREEIL 358
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    
MAYHNPLSQD LPLHFSDQQP PQNQPRSDAS LSTILPDPKS HHHHHHPPQT APNWLNNALL  60
RNQNPHSHYS TDTTTTATAA VNTNFLNLHT TASDSTVSHS SNQWLSRPIL QRNHSDVIND  120
VAAAAAGDNM IGAANDANSG DGLNKSDGMA VEPGGGGGGG EGVLNWQYAR YKTEILAHPL  180
YEQLLSAHVA CLRIATPVDQ LPRIDAQLAQ SQNVVAKYSA LGHTAPLMVG DDKDLDQFMT  240
HYVLLLCSFK EQLQQHVRVH AMEAVMACWD IEQSLQSLTG VSPGEGTGAT MSDDDDDQVD  300
SDSNLFEASL DCPDTMGFGP LIPTETERSL MERVRQELKH ELKAGYKEKI VDIREEILRK  360
RRAGKLPGDT TSVLKQWWQS HSKWPYPTEE DKARLVQETG LQLKQINNWF INQRKRNWHS  420
NPSSSTNLKS KRKRSNAGEN SSNCFK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1414434RKRNWHSNPSSSTNLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0TALE family protein