PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022979101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 349aa    MW: 39341.3 Da    PI: 6.6935
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022979101.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.3e-092753092155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_022979101.1 275 KWPYPSESQKVALAESTGLDQKQINNWFINQRKRH 309
                     569*****************************885 PP

2ELK37.64.6e-13229250122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYs yLgsLkqEF+
  XP_022979101.1 229 ELKGQLLRKYSRYLGSLKQEFM 250
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    
MDGPSGSSSG GGMMNFVDQN SHNGFSSMMM MMPLMSSSHQ QQHHQGDACS SFLPPPPPPP  60
NYTNNNTSNS ISYFLGETNS NININEGSNG NSCCELKAKI MGHPHYHRLL VAYVNCRKVG  120
APPEVVARLE QACASAATMS GTSCIGQDPG LDQFMEAYCE MLTKYEQELS KPFRDAMLFL  180
QRIECQFKAL SISSSSDAGC GEAFDRNGSS EEEVDMNGQS IDPWAEDHEL KGQLLRKYSR  240
YLGSLKQEFM KKRKKGKLPK EARQQLLDWW SRHYKWPYPS ESQKVALAES TGLDQKQINN  300
WFINQRKRHW KPSEDMQFVV MDAAHHHPQY YMDSVLGNPF PFDISPTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1245254LKQEFMKKRK
2251255KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-133TALE family protein