PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022978165.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 461aa    MW: 51841.8 Da    PI: 6.9573
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022978165.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-092963331954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  XP_022978165.1 296 FEHflHPYPTDTDKLMLANQTGLSRSQVSNWFINARVR 333
                     564459******************************88 PP

2BELL89.43.8e-29170239372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e +++k++L+++l+eV++rY+ y++q+q+v+  Fe v glg+a+pY++lA ka+ +hFr Lk+aia+q+
  XP_022978165.1 170 IESRRRKSRLITMLDEVYRRYRLYYQQMQAVVTTFEYVGGLGNAAPYANLAVKAMFKHFRFLKNAIADQL 239
                     58899***************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    
MAEGFELYHV PQQSRRDKLR VGVGSGATNN PNFLPLYHDD DGDPSSLISP DFDFHQNPSF  60
NLHNHNHYPP TPPAAFATTA HHLPPLLPDQ QQPPLSLDLN LQHRYASSPA AFSPLLTSKF  120
LKPAQQLLHD LFHYAGKFPP DSPLVDPLLD SLGADIPTAA LHHDPTDDGI ESRRRKSRLI  180
TMLDEVYRRY RLYYQQMQAV VTTFEYVGGL GNAAPYANLA VKAMFKHFRF LKNAIADQLQ  240
LNKQHQQQQQ PPPPYNPYCQ RSIHNNSGGF VDHQPVWRPQ RGLPESAVTV LRAWLFEHFL  300
HPYPTDTDKL MLANQTGLSR SQVSNWFINA RVRLWKPMVE EIHMLETREA QKSQHRDANN  360
GTPLNNNDDH LSSTNQSLNN ASSSNHDQHP LHLSSSNFFP THHPHAPAGA TTMGAGNVSL  420
TLGLHQNHGG ITLTEPFPIN AAQHFNLGLE ANGEGFVNEW F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172177SRRRKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-63TALE family protein