PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022977654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 630aa    MW: 68976 Da    PI: 7.3712
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022977654.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.64.9e-094374741954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_022977654.1 437 FEHflHPYPSDADKLLLARQTGLSRNQVSNWFINARVR 474
                     664559******************************88 PP

2BELL113.71e-36297368172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLls+l+eV++rY+ y+eq+q+v++sF+ v+g g+a+pYt+l +ka+SrhFrcLkda+aeq+
  XP_022977654.1 297 DRIEHQRRKVKLLSMLDEVERRYNLYREQMQMVVNSFDLVMGFGAAAPYTTLTQKAMSRHFRCLKDALAEQL 368
                     589*******************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    
MGIAKAPLIF STNSSMSHHF HQHQVKINLL PQQIRPLHSF SDSIPPSTVA GTDPQLHHVY  60
APAPTPGTML SEIFNFPPPS SSAAVEFSDN LPTLRPPNSA ALMPLFLMNP PPPLRSPSSP  120
STSSTLHMLL PNPHGGFEGG VGVGDQVEFG QFVVESRGLS LSLHSSDGGV KGDELGVRDG  180
GVLSSYNNNN QVRDGGSGST SSILQYSLKN NSDNSPLASQ IMNPNHQVQI GFGSSLGVVN  240
VLRNSRYVKP TQELLEEFCS VGKVQFKKKK FNTETTTTAA GGSSSSSKDQ PPLSAADRIE  300
HQRRKVKLLS MLDEVERRYN LYREQMQMVV NSFDLVMGFG AAAPYTTLTQ KAMSRHFRCL  360
KDALAEQLKQ SYEALGEKGG NGGYGVTKGE TPRLKLLEQS LRQQRAFHQM GMMEQEAWRP  420
QRGLPERSVN ILRAWLFEHF LHPYPSDADK LLLARQTGLS RNQVSNWFIN ARVRLWKPMV  480
EEMYQLEDKV ETDHQSDHHQ GSEDNNNQTK NSDMNAQNPT PTTSSAAPPP SATTAAAQQL  540
TAAFTATHEY SELHDVWRHG SGDHQHYETV TGTDNMNNHG PTLIRFGPTA TTTGDVSLTL  600
GLRHTGNTSS SSSSAAAGNP SFFLRDFGHS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.21e-118TALE family protein