PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022977057.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 371aa    MW: 42580.7 Da    PI: 6.7975
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022977057.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-092983332055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_022977057.1 298 YKWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 333
                     5679*****************************885 PP

2ELK37.93.8e-13253274122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  XP_022977057.1 253 ELKNHLLRKYSGYLSSLKQELS 274
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    
MEEYNNHVNE NSNPRGNFLY PSGVVRGNSS SGNFGRSSNP TAQMGLNSFH LQQGTDCFQT  60
DHSHPIVKTE ASSSHHQLHK FHHPLLRGGG GQPPPTTCRP DQHGLLDVEA IKAKILAHPQ  120
YSSLLEAYME CQKVGAPPQV VERLVAARHE FETRQRSSMV SGETIKDPEL DQFMEAYYDM  180
LVKYREELTR PIQEAMDFMR RVESQLSSLC NGPLRIFNSD EKCEGMGSSE EEQENSGGET  240
ELPEIDPRAE DRELKNHLLR KYSGYLSSLK QELSKKKKKG KLPKDARQKL LNWWELHYKW  300
PYPSETEKVA LAESTGLDQK QINNWFINQR KRHWKPSEDM QFMVMDGLHP PNTTLYIDGH  360
YMTDAHYRLG P
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-129TALE family protein