PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022976160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 456aa    MW: 50908.5 Da    PI: 6.5895
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022976160.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-074054382154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_022976160.1 405 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 438
                     469*****************************87 PP

2ELK223.9e-08359380122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+ +Y+++++++++E++
  XP_022976160.1 359 ELKHELKSGYKEKIVDIREEIL 380
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    
MAYHNHLSQD LPLHFSDHQQ HHQNQPLSDT SLRTILPDQL AGGHSSPDPK SHHHHHHHPL  60
QTAPNWLNNA LLRNQNPHSH YSTDTVTTAA AAAANTNFLN LHTTASDSTV SHSSNQWLSR  120
PILHRNHSDV IDDVTASAGD AMIGAATAAL SHDSGEMKND ANSGDGMNKS EGMVMEPSAG  180
GEGVLNWHNA RYKAEILTHP LYEQLLSAHV ACLRIATPVD QLPRIDAQLA QSQNVVAKYS  240
ALTHTAPPPM VGDDKELDQF MTHYVLLLCS FKEQLQQHVR VHAMEAVMAC WDIEQSLQSL  300
TGVSPGEGTG ATMSDDEDDQ VDSDANLFDG SLEGPDTMGF GPLIPTESER SLMERVRQEL  360
KHELKSGYKE KIVDIREEIL RKRRAGKLPG DTTSVLKQWW QSHSKWPYPT EEDKARLVQE  420
TGLQLKQINN WFINQRKRNW HNNPSSSTNL KSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1436456RKRNWHNNPSSSTNLKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-179TALE family protein