PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022971683.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 696aa    MW: 76375.9 Da    PI: 6.2427
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022971683.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.3e-094745111954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_022971683.1 474 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 511
                     664559******************************88 PP

2BELL122.22.1e-39334405172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLls+l+eVd+rY++y+eq+q v++sFe+v+glg+a  Yt+lA+ka+SrhFrcLkdai++q+
  XP_022971683.1 334 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQLVVNSFEEVMGLGAAVAYTALAQKAMSRHFRCLKDAIVGQL 405
                     589******************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    
MGIVAHPLQF LFFTIFLQQF QQFHCDSMSQ QDYQQAAAAA AAAAGFFTPF SNGFDRSSTA  60
HQDPQQHYQH IAHQIRKEKL RLQGFHPPPH PPSLVGIDDD EDDQSAGAAG LHHVYDSAGI  120
LSEMFNFPPP PPPPPPQTEL YGNREAMNAA DSAVAMQLFL MNPNPRSPSP PPPPAVSSTL  180
HMLLPNPASG GSFGQFTWGV VPEQQTGDHS SSNPNEGRLS LSLSSSLEAA KAEELRMGDS  240
ASGLLYQTHH HPQHVHVGIG SSNPLGVVNL LRNSKYVKAA QELLEEFCSV GRGQFKRNKS  300
NLPSNSNSHG GDGAGVSSSA AKDHQLQPAL SAADRIEHQR RKVKLLSMLD EVDRRYNHYC  360
EQMQLVVNSF EEVMGLGAAV AYTALAQKAM SRHFRCLKDA IVGQLKQSCE MLGDKDGGRA  420
SGITKGETPR LKLLEQRLRQ QRAFHQMGIM DQEAWRPQRG LPERSVNILR AWLFEHFLHP  480
YPSDADKHLL ARQTGLSRNQ VSNWFINARV RLWKPMVEEM YQQEAKEEEE DDDDDDEDNT  540
DEDTKTNPHQ ITSNALSQTP TPPSDATPPP PPKGLDHTTL SHPPPFSQSQ QYSSAAAAAA  600
ATQAPPTPSM VANCFPATHY DSELQDTCQR VSVLTAPDHQ FGTTNTSATS DIQGPTTLIR  660
FGTTTGDVSL TLGLRHAGNI PDKNPSFSLR SEFGEC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-130TALE family protein