PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022971235.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 406aa    MW: 45474.1 Da    PI: 6.9581
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022971235.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.3e-092582902254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yps +++  LAk++gL+ +qV++WF N R +
  XP_022971235.1 258 HPYPSDTDKLMLAKQTGLSRSQVSNWFINARVR 290
                     89*****************************88 PP

2BELL61.22.4e-20169221860
            BELL   8 kkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrh 60 
                      k+ L+s+l+eV+++Ykqy++q+q v+ sFe + glg+a+pY++ A kai r+
  XP_022971235.1 169 NKSTLVSMLDEVYRKYKQYYQQIQEVMTSFEYISGLGNAAPYANQAIKAIQRS 221
                     6999**********************************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    
MADGIESFDH VPQQSRRDKL REQLDRSSFL PFYDPSLISS SDILSTAAAA AANNPLFQFH  60
HPFFDTQIPS SLLPDSNNPV LLNHCYAAFK PGPLSLSLSS QPYLSTVNVP LGPFTGYASI  120
LKGSRFLEPA QQLLEELCDV VGLRRTQSSS ATSDSLSDCG VVHHSFTFNK STLVSMLDEV  180
YRKYKQYYQQ IQEVMTSFEY ISGLGNAAPY ANQAIKAIQR SVQNPGFLDL QPVWRPQRGL  240
PEQAVTVLRG WLFDHFLHPY PSDTDKLMLA KQTGLSRSQV SNWFINARVR LWKPMVEEIY  300
NLETKQTQKN CHREEDRNAH PPSRNEPHDI PLGIQDEASN ICYNLSSHPH MASNNNNGGV  360
SLTLGLHQNN GIGGFRVGYV MGGHFGRDVV GTQLLHDFVG RNSLWL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-62TALE family protein