PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022971233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 433aa    MW: 48683.8 Da    PI: 7.5156
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022971233.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-092853172254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yps +++  LAk++gL+ +qV++WF N R +
  XP_022971233.1 285 HPYPSDTDKLMLAKQTGLSRSQVSNWFINARVR 317
                     89*****************************88 PP

2BELL78.78e-26169233872
            BELL   8 kkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      k+ L+s+l+eV+++Ykqy++q+q v+ sFe + glg+a+pY++ A ka+ +hF++Lk+ i eq+
  XP_022971233.1 169 NKSTLVSMLDEVYRKYKQYYQQIQEVMTSFEYISGLGNAAPYANQAIKAMYKHFQSLKNGILEQL 233
                     6999**********************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    
MADGIESFDH VPQQSRRDKL REQLDRSSFL PFYDPSLISS SDILSTAAAA AANNPLFQFH  60
HPFFDTQIPS SLLPDSNNPV LLNHCYAAFK PGPLSLSLSS QPYLSTVNVP LGPFTGYASI  120
LKGSRFLEPA QQLLEELCDV VGLRRTQSSS ATSDSLSDCG VVHHSFTFNK STLVSMLDEV  180
YRKYKQYYQQ IQEVMTSFEY ISGLGNAAPY ANQAIKAMYK HFQSLKNGIL EQLKFNKRTH  240
GGDYSQRSVQ NPGFLDLQPV WRPQRGLPEQ AVTVLRGWLF DHFLHPYPSD TDKLMLAKQT  300
GLSRSQVSNW FINARVRLWK PMVEEIYNLE TKQTQKNCHR EEDRNAHPPS RNEPHDIPLG  360
IQDEASNICY NLSSHPHMAS NNNNGGVSLT LGLHQNNGIG GFRVGYVMGG HFGRDVVGTQ  420
LLHDFVGRNS LWL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-76TALE family protein