PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022970306.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 570aa    MW: 63757.2 Da    PI: 6.643
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022970306.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-094004371954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  XP_022970306.1 400 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 437
                     564459******************************87 PP

2BELL113.61.1e-36266334472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e qkkkakLl +l+eV++rYkqy++q+q+v+ssFe vagl sa+pY+slAlk++SrhF++Lk+ai+eq+
  XP_022970306.1 266 EYQKKKAKLLYMLDEVCRRYKQYHQQMQMVVSSFESVAGLSSATPYISLALKTVSRHFQSLKNAISEQL 334
                     89*****************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    
MEHSYGFEHV AQQSRRDKLR VSRNSDEQLS FQNSGHSGLD LDLVRIQNFN KNSILPSVMI  60
NFSRDSDIML SQELVGDASL GSVSNYWKSS DWEMNCGNNC LGGEMLNDST VYTLQDVVNQ  120
TAACEGRGNE SNVLPYDTTG FVSDSNPQRL ALSLSSNTQF QESEESKTVK SETIGNKNYG  180
KSLQNMMGVS VNPYRNTGPL GPFIGYATIL KSSKFLKPAQ LLLDEFCSSN AHKFVQPCES  240
SPALNADDET NISGVGSISS ESHQPEYQKK KAKLLYMLDE VCRRYKQYHQ QMQMVVSSFE  300
SVAGLSSATP YISLALKTVS RHFQSLKNAI SEQLKYLRKV VGEDSSSISA GTSGRKYMEQ  360
SFQKQKTGIV NIGFLESQNV WRPHRGLPER AVAILRAWLF EHFLHPYPTD TDKHMLATQT  420
GLSRNQVSNW FINARVRVWK PMVEEIHMLE TNGMAEMNNK GHVTIENTAG WTSSEQQPLK  480
SHGDVNEIIT SQWDQGKPSR LDNGVQSNTE GELMGFVPYR ASAVDVGGVG TVSLTLGLRH  540
RVESAHHQQQ QQDEQLLRHY GSEMIHDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-93TALE family protein