PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022970025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 582aa    MW: 64600.7 Da    PI: 6.0363
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022970025.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.7e-093103471954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_022970025.1 310 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 347
                     664459******************************88 PP

2BELL108.44.3e-35172242272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     ++elqk+k+kL slleeV++rYk+y+eq+++v++sFeavag g a++Y +lA+ka+S+hFr+Lkd i++qi
  XP_022970025.1 172 FMELQKRKTKLFSLLEEVERRYKHYCEQMKAVVASFEAVAGNGVARVYSALASKAMSKHFRSLKDGIVGQI 242
                     689******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    
MAGEDKSNEM VVGGFYYNSI QIQPGFGSST EPAEMFNLQV NNEFGGGGGG GDDEFHHHLM  60
VVGPWGTTAG AAEAADSSLR CVFPCEANER PSHGLSLSLS STNPSSIGLQ SFELRTQQSS  120
SAIFQLRNSK FLAPTQELLY EFCSLEITND MNNRHQNQAI SSTNSSLQSL DFMELQKRKT  180
KLFSLLEEVE RRYKHYCEQM KAVVASFEAV AGNGVARVYS ALASKAMSKH FRSLKDGIVG  240
QIQATKKAMG EKDPIAPGTT RGETPRLRVI DQALRQQRAF HQISIMESHP WRPQRGLPES  300
SVSILRAWLF EHFLHPYPSD VDKHILARQT GLSRSQVSNW FINARVRLWK PMVEEMYLEE  360
TKEQVEEIDN TNFNNMNNNG NNSFHGMMDF DDEIDGQRSI PTGVEDRKPT SDQLLKIDSE  420
GLSSIISNSS EKNDSRAMKA MQNYQGQHVH NNHNHNFGRI AADAFDMVEL NFSSYNHDSG  480
GVSSYLNNNN NQHFNNGNSS SVSLTLGLQQ HAAGGRNISE GVSIAFSPVA AAAAATQSSI  540
FFTRDHIEEC QPVQYSVLDG ETTQNLPYRN LMGTQLLHDL AG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-103TALE family protein