PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022969863.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 295aa    MW: 33355.6 Da    PI: 6.3752
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022969863.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-072442772154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++ +L +++gL+ +q+ +WF N+R +
  XP_022969863.1 244 KWPYPTEDDKSKLVEETGLQLKQINNWFINQRKR 277
                     469*****************************87 PP

2ELK25.53.1e-09198219122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_022969863.1 198 ELKIELKQGFKSRIEDVREEIL 219
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    
MQEAGLGIMN GGGGSSGDVL VSGEGVYNAQ LKAEIATHPL YEQLLSAHVS CLRVATPIDK  60
LPMIDAQLSQ SHHVLRSYAS SHQNAHSLSP HDRQELDNFL AQYMIVLCSF KDQLQQHVRF  120
HAVEAVMACR EIESTLQALT GVNLDEGTGL TMSDNDDDDV PMDFALDQSS TDAHDMMGFG  180
PLLPTESERS LMERVRQELK IELKQGFKSR IEDVREEILR KRRAGKLPGD TTTVLKNWWQ  240
QHSKWPYPTE DDKSKLVEET GLQLKQINNW FINQRKRNWH SNSQSVTFLK SKRKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-159TALE family protein