PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022966726.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 324aa    MW: 36746.6 Da    PI: 4.7999
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022966726.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.74.6e-092663002155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+++++  LA+++gL+++q+ +WF N+R ++
  XP_022966726.1 266 KWPYPTEADKVALAERTGLDQKQINNWFINQRKRH 300
                     679*****************************885 PP

2ELK26.81.2e-09220241122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     +LK+ Llr ++++++sLk EFs
  XP_022966726.1 220 DLKDKLLRRFGSHISSLKLEFS 241
                     69*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    
MEEMYGLQST AEYSDKALMS PENLILPPDY QSLLVTSGEF RDRIPVFGSN ELLSAAASVI  60
SEAEAASITM EIQCEEDMVN VIKAKISSHP TYPRLLDAYI DCQKVGAPPA ISHLLEGIRQ  120
ESDICNRHAV TTCLGVDPEL DEFMETYCDM LVKYKSDLKR PFDEATTFLN KIELQLSNLC  180
NGAFSRSLSD EGAASSDEEL SGGEMEAVEA EAQTKGEKRD LKDKLLRRFG SHISSLKLEF  240
SKKKKKGKLP KEARQTLLEW WNVHYKWPYP TEADKVALAE RTGLDQKQIN NWFINQRKRH  300
WKPSESMQLE GMDELSSGRF FRED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-128TALE family protein