PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_022966653.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita
Family TALE
Protein Properties Length: 446aa    MW: 49764.6 Da    PI: 6.7549
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_022966653.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-092823191954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  XP_022966653.1 282 FEHflHPYPTDTDKLMLASQTGLSRSQVSNWFINARVR 319
                     564459******************************88 PP

2BELL87.11.9e-28162230472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + ++kk++L+++l+eV+krYk y++q+q+v+  Fe +aglg+a+pY +lA  a+ +hF+ Lk+ ia+q+
  XP_022966653.1 162 DSRRKKSRLVTMLDEVYKRYKLYYQQMQAVVTTFEYAAGLGNAAPYMNLAVTAMFKHFKFLKNTIADQL 230
                     6789**************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    
MAEESFEVYH VPHQSCRDKL RVGIANNNHN SHIAAALLPL CHPSSFISSH FDSHPLPQNP  60
SFHYPPPPPP TAAAAHVPPL LPDQPLSLDL NLQQRYASAL PFVGYSASLL KGSKFLKPAQ  120
QLLHDLFDNS PPDPLLLDPL LESLAGDIPD PITSTDDDGG ADSRRKKSRL VTMLDEVYKR  180
YKLYYQQMQA VVTTFEYAAG LGNAAPYMNL AVTAMFKHFK FLKNTIADQL QFNKKNQQPY  240
NPYCQTSIHN NTNAPFVDHQ PVWRPQRGLP ESAVTVLRAW LFEHFLHPYP TDTDKLMLAS  300
QTGLSRSQVS NWFINARVRL WKPMVEEIHM LETRQARKSH QNDENDDNDN DHISSHNGNN  360
NNASSSHHDH NQLNLSNSNF IPTHHPHVAA GAAHMGGGGG GNVSLTLGLH QNYGGITLTE  420
PFPINAAQHF NFGLEGNGEG FVNEWF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.19e-76TALE family protein