PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024996884.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 414aa    MW: 48180 Da    PI: 6.7458
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024996884.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.6e-093403771954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     F++   +yp+ +e++ LA k gLt +qV++WF N R +
  XP_024996884.1 340 FQNflRPYPKDSEKQLLAVKSGLTRSQVSNWFINARVR 377
                     7766789*****************************98 PP

2BELL445.6e-15221283972
            BELL   9 kakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + +Ll ll++Vd++++++  +++ v s+F++v++l++ ++++s+Al++iS    +L+ ++ ++i
  XP_024996884.1 221 RKHLLVLLQQVDEQFNRCLSEVHRVKSAFHVVTELDP-RMHASFALQTISLFRNNLRKRLRNRI 283
                     469**********************************.************88788999887765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    
MENNGMSMAL GILDESFPTF LDQTHNFPIN HTDLTQHFQP DFPSVVNTDE APSYDAYEHF  60
GFDRMIADYV NTKWDHSNQF FEPPKEHSGF HTQMDSWVSS ENNSSLSSDS NGWPSLNLDT  120
DSRISGLLLM DNSKQDHFCN SKSMSSSRSD FDDDRQIQLL SQSHQSGSKR YLTMIQEILS  180
EITTCFLGDV EKTSHKQMDL NDRFEGHNHP ELRGLGVKAI RKHLLVLLQQ VDEQFNRCLS  240
EVHRVKSAFH VVTELDPRMH ASFALQTISL FRNNLRKRLR NRILAVGPDL NEIDPKESEL  300
SSLLRKHWAH QRLRGKGQQL WKPQRGLPEK SVSVLREWIF QNFLRPYPKD SEKQLLAVKS  360
GLTRSQVSNW FINARVRFWK PMIEEMYVEM KTMTTAGDEE TESNHRIRTH HQEH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276282RKRLRNR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.14e-66TALE family protein