PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024996727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 694aa    MW: 77076.6 Da    PI: 6.8877
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024996727.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-095245562254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yps +++  LA+++gLt +qV++WF N R +
  XP_024996727.1 524 HPYPSBADKHMLATQTGLTRNQVSNWFINARVR 556
                     89*****************************87 PP

2BELL100.99.3e-33372440472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e ++kka+Ll ++eeV++rYkqy +q+q+v+ssFe+vaglg+a+pY+ lAlkaiSrhF  +k+ i+eq+
  XP_024996727.1 372 EFHRKKARLLYMQEEVCRRYKQYLQQMQMVVSSFETVAGLGAATPYVCLALKAISRHFHFVKTVISEQL 440
                     7899***************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    
MEMNNLRVES HVAQKNRRHK LRFQQNSGDM NHQHPPQDHP QFEPKDIHRP FSYNPNVYPS  60
EMLNSVPRNP HLLLPLGHGF VSVDQDSFPG SDSGSGMGSS QPDQRILAGS NGGTFANLPN  120
DSNNWKTVVS SQQVGNDHWN LVSYSNTGSM NIDHRSLNSG GYGYHQDVQN VPAFSSSPFY  180
HSILPEDQVT LAQPHQGKND SGMNQSIPYW MNNSDESSYL ANRIHDHREQ MTTATTMAAN  240
EGNCNTQALC LSLSSVPQPK DDLLTLQPGE RPLKSDLLPN SDLKCFMGVS SFAHRNAGPL  300
GPFTGYATIL KNSKYLKPAQ ELLNVNCEVG DQELLQTCHD VFSQKILEEE MSRASGGSNE  360
HSTSGAESLQ PEFHRKKARL LYMQEEVCRR YKQYLQQMQM VVSSFETVAG LGAATPYVCL  420
ALKAISRHFH FVKTVISEQL LQIRKMVGEG LSSSTTTSSK VFDANATSTS RLKSIDQRLS  480
KSGGGVGGAA GFFTSPQPVW RPQRGLPERA IAVLKTWLFD HFLHPYPSBA DKHMLATQTG  540
LTRNQVSNWF INARVRIWKP MVEEIHTLET KGLAEPNSTN PPPAGQDSSR MDMSSFSNMQ  600
PPEQSCSRNP QTALTGDEPN DQQLQDHEKL ARPEYQIPLA SMDRLMSILP YPRATFDASG  660
LGPVSLTLGL RQNAENVQQL QQHFGGQLIH DFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.18e-84TALE family protein