PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024994829.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 612aa    MW: 68372.8 Da    PI: 6.5597
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024994829.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.5e-093924291954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_024994829.1 392 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 429
                     664459******************************88 PP

2BELL116.61.2e-37254324272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + elqk+k+kLl++leeVd+rY++y++q+++v+ssFeavag g+a++Y +lA+ka+SrhFrcL+d +++qi
  XP_024994829.1 254 FLELQKRKSKLLQMLEEVDRRYNHYCDQMKAVVSSFEAVAGNGAATVYSALASKAMSRHFRCLRDGVVGQI 324
                     569******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    
MVEEGKIIEG NNMMVGTATN FDPYVNSSSN PNTDVSYGGG THTSEFFNFD QHNSVSHNSD  60
LFWKPSSPKP IMIPGGGAAA GDFCQFDESS LQRCVLIPCE PNERPSQGLS LSLSSTNPST  120
IGIQPFELVR PPQDHHHHHQ QQQQHQGYFG KPMNMHEQHD MMTDDQDDEF LRKSGNIMNS  180
GSGGSQHQSA QYHIRSSRYL VPAQDLLNEF CNLGTKQIDR STKAKRTSQW QDHDNLNHSN  240
ASSSKNKPLN SLEFLELQKR KSKLLQMLEE VDRRYNHYCD QMKAVVSSFE AVAGNGAATV  300
YSALASKAMS RHFRCLRDGV VGQIKATKKA MGEKDISAPG ATRGETPRLR LLDQTLRQQR  360
AFQQMTMMDS HPWRPQRGLP ERSVSILRAW LFEHFLHPYP SDVDKHILAR QTGLSRSQVS  420
NWFINARVRL WKPMVEEMYV EETKENDNEN DEDVHDRSFN VAIDENNAIP QMEQKPTVEQ  480
LIRRDSECLS SIINHHHHTT KTLDHDFHQN FTRVSSEPFG AVELDFSAYN HSFGGSTGGG  540
VSLTLGLQQH AGGGGGGGGG GGGGGVSLFY PRDHMEDCQT AVQYSSLLEG DQGQNLPYRN  600
LMGAQLLHDL AG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-122TALE family protein