PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024994763.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 490aa    MW: 55202.2 Da    PI: 6.1978
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024994763.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-094224601854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  XP_024994763.1 422 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 460
                     5887779******************************88 PP

2BELL73.82.8e-24300366572
            BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +++kk +Ll lle+Vd+rY+q+ ++++tvis+F+av++l++ ++++ + l++i++ +++L+++i+++i
  XP_024994763.1 300 VEMKKKHLLALLEMVDERYNQCLDEIHTVISAFHAVTELNP-QIHACFSLHTITFFYKSLRERISNHI 366
                     789**************************************.***********************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    
MENSGFNMPM GMAAENFIIP DENYPPAAMV SFNQKAFLDQ NHHIMPGFPM LSMIPGEPVN  60
GSGITNPTEH LGSNFPSIGH MDVPISATAL AALLASRHGQ QESLNFPLFG QSLEVPKSVV  120
PNNHFPDTLP SLFNAAENFG YDGTMGDMSR KWDFNKFFMP PTERMGFDTH PNGWISSENN  180
ASVSSDGNEL SLSLATCSGM SNLSLHGRQL GSTEQASSCN SKSFSLGFNS NSNRPIPVLQ  240
CSSGSNTYLH IMQEILSEIA SYSLGNFDQM GYKQIGSDDF SDGNNTFEDH INPILKSRGV  300
EMKKKHLLAL LEMVDERYNQ CLDEIHTVIS AFHAVTELNP QIHACFSLHT ITFFYKSLRE  360
RISNHILSMG ADYNTMDPGE EELSSFVPKQ WALQQLRRKD HQLWRPQRGL PEKSVSVLRA  420
WMFQNFLHPY PKDAEKQLLA VKSGLTRSQV SNWFINARVR LWKPMIEEMY LEMNRRSRDE  480
ETARNSQYHT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-96TALE family protein