PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024993711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 299aa    MW: 33744.1 Da    PI: 6.4487
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024993711.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.2e-072492812254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_024993711.1 249 WPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 281
                     58*****************************87 PP

2ELK25.14.1e-09202223122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_024993711.1 202 ELKIELKQGFRSKIEDVREEIL 223
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    
MQEQGLGMMG GGGGIGGGFT DMSVSLSGDQ NRQLKAEIAN HPLYEQLLSA HVACLRVATP  60
IDQLPLIDAQ LSQSHHLLRS YIAADHHNQP LSPHDRQDLD NFLAQYLLVL CSFKEQLQQH  120
VRVHAVEAVM ACREIEHNLQ ALTGVTLGEG SGATMSDDED EMPMDFSLDQ SGGIDGSHDM  180
MGFGPLLPTE SERSLMERVR QELKIELKQG FRSKIEDVRE EILRKRRAGK LPGDTTSVLK  240
DWWQQHSKWP YPTEDDKAKL VEETGLQLKQ INNWFINQRK RNWHSNSNSM TALKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279299RKRNWHSNSNSMTALKSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-171TALE family protein