PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024990116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 324aa    MW: 36546 Da    PI: 5.3032
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024990116.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-082663002155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp++ ++  LA+ +gL+ +q+ +WF N+R ++
  XP_024990116.1 266 KWPYPTEGDKISLAETTGLDPKQINNWFINQRKRH 300
                     579*****************************885 PP

2ELK32.61.8e-11220240121
             ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                     ELK+ LlrK++g++gsLkqEF
  XP_024990116.1 220 ELKDTLLRKFGGRIGSLKQEF 240
                     9*******************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    
MDEMYGFHST SGYTVSPENN LILPAEHQSS VDQYWPFYGS DDLLSVAASV ISDAVSIETN  60
PDRIILPRRR SNRPRDQAKN GGLDVAAADD ASGDRIKEKI ASHPSYSKLL AAYIDCQKVG  120
APPEIACLLD DIRLENDVRK RNATASTCLG IDPELDEFME TYCHVLVKYK SDLARPFDEA  180
AVFLGNIETQ LRNLCKDEVT ISSEEEFSGG ETDNAQMSQE LKDTLLRKFG GRIGSLKQEF  240
TKKKKKGKLP KEARQTLLEW WNSHYKWPYP TEGDKISLAE TTGLDPKQIN NWFINQRKRH  300
WKPPENMQLA VMGGGLPGQH FYDD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-105TALE family protein