PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024987871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 329aa    MW: 37495.7 Da    PI: 4.9676
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024987871.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-092713052155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+++++  LA+++gL+++q+ +WF N+R ++
  XP_024987871.1 271 KWPYPTEADKIALAESTGLDQKQINNWFINQRKRH 305
                     569*****************************885 PP

2ELK34.15.7e-12225246122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK+ LlrK++g+++sL++EFs
  XP_024987871.1 225 ELKDTLLRKFGGHISSLRHEFS 246
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    
MEEMYGFNSM SDYTISPETN LISSSEYHGV TSTSVDHYRT FYGSDNLLSA AASVISEAVS  60
LAATPHQILL PRTRSSRQRD QNKNDSDHHH VDVCDDIIKA KIASHPLYPK LLDAFIDCQK  120
LGAPPEIASL LDEIRRENDV RLRNAASSTC LVADPELDEF METYCQVLVK YKSDLARPFD  180
EATVFLNNIE TQLSNLCKDD GTVSSEEEFS GGETENTQVS REEQELKDTL LRKFGGHISS  240
LRHEFSKKKK KGKLPNEARQ TLLEWWDSHY KWPYPTEADK IALAESTGLD QKQINNWFIN  300
QRKRHWKPSE NMQLAIMGSF SGNQDFYDD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-105TALE family protein