PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024987787.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 364aa    MW: 40280.2 Da    PI: 6.3727
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024987787.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092943282155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_024987787.1 294 KWPYPSEAQKLALAESTGLDQKQINNWFINQRKRH 328
                     569*****************************885 PP

2ELK41.13.7e-14248269122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_024987787.1 248 ELKGQLLRKYSGYLGSLKQEFM 269
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    
MDGHAGGGGG GTSSLMGFGE NNSLNRSSNG DNNNSIGSLC LPPPVIYNNT LIFSTQDHHH  60
HHNNCGTSAS AMMLEDNNNS NINDGGGLGF ISSSSSCSSS VKAKIMSHPH YPRLLSAYLN  120
CQKIGAPPEV VERLEEACRA SVMMAGRAST GGGGGGMNTT IVGQDPALDQ FMEAYCEMLI  180
KYEQELSKPF KEAMLFLSRI ESQFKAISFS TSDSACGEGG MDRNVSSEEE VDVDVNNNMV  240
DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWT RHYKWPYPSE  300
AQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVM DAAHPHYFMD NIFGNPYPMD  360
VSLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264273LKQEFMKKRK
2270274KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-123TALE family protein