PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024986983.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 715aa    MW: 79732.5 Da    PI: 7.3127
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024986983.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-095375692254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yps +++  LA+++gLt +qV++WF N R +
  XP_024986983.1 537 HPYPSDADKHMLATQTGLTRNQVSNWFINARVR 569
                     89*****************************87 PP

2BELL107.86.8e-35386455372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e ++kkakLl ++eeV++rY+qy++q+q+vissFe+vagl sa+pY+slAlka+SrhF c+k ai+eq+
  XP_024986983.1 386 PEFHQKKAKLLYMQEEVCRRYRQYHQQMQMVISSFETVAGLSSATPYVSLALKAVSRHFHCVKCAISEQL 455
                     5889****************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    
MEMNNLRTES HVAQKSRRHK LRFQHNSDDP NHQHLSQDPH FELHRPARYG SISYDPSVFP  60
SEMLNSIASN PHLLLPPSHA FLSHDQDSAT GSSPASFPHS VSCKVIADNP QNGGNWKSVV  120
SSSQSQLQVN SDSWNVVSYS NGGASSKPTY GYNQDLQNIH LGDQKNYGEV PAFGSTPYYH  180
NTLQEVVTSA TVGTHVHQSK NFLEISQSIP CWMNTSDQLG FIANRNNDHR EGTMMGATNE  240
NNCITQGLSL SLSSVPQPKT EFPNIHSGPK AALKTDLLAN SDSKQLMGMS SFAHRNVGPL  300
GPFTGYATIL KNSKYLKPAQ ELLNDNCDVG GHELVQSCDN THKILDEEMS RVSGESGTSG  360
ASSSTIYGSN EHITGRSSSL PESYRPEFHQ KKAKLLYMQE EVCRRYRQYH QQMQMVISSF  420
ETVAGLSSAT PYVSLALKAV SRHFHCVKCA ISEQLTQMKK TFEDLCSPTV GASSSKNFDA  480
NSTDTLSQLK SMDHNYQRQG KSGGFFGNQQ PVWRPQRGLP ERAVSVLKAW LFDHFLHPYP  540
SDADKHMLAT QTGLTRNQVS NWFINARVRI WKPMVEEIHT LETKGLADSN TNNPTPTDGQ  600
DTSRMDMSSL SNKQQPECSR TSGTLTMMNG QNEPNEQLWD HEKRSRPEYQ IPPATMDRSF  660
TSIIPYPRTT FEAGVGPVSL TLGLRQNAEH VQQLQQHEHQ LRQRFGGQLI HDFVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.16e-83TALE family protein