PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024986770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 634aa    MW: 70696 Da    PI: 6.5788
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024986770.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.3e-084054421954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+  ++  LA+++gL+ +qV++WF N R +
  XP_024986770.1 405 FEHflHPYPNDVDKHILARQTGLSRSQVSNWFINARVR 442
                     554459******************************88 PP

2BELL119.12e-38266337172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e++elqk+k+kLl++leeVd+rYk+y++q+++v+ssFeavag g+ak+Y slA+ka+SrhFrcL+d i++q+
  XP_024986770.1 266 EFMELQKRKTKLLQMLEEVDRRYKHYCDQMKAVVSSFEAVAGNGAAKVYSSLASKAMSRHFRCLRDSIVSQM 337
                     679******************************************************************995 PP

Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    
MAEEEEKIIR GNDIMVGSST GNYNCYTDDH HVNSSSNHNP TTSFETSPLE MFNFESHNPV  60
SHHNSVLFWK GPSPPPSSKP ITDSISAGDF YHFDESSLQR CVFSCEPNER PSQGLSLSLS  120
SANPSTIGIQ PFELARPQEH QYQHHHQQGY FGKSMSIDHD QHHQDMMTQD GFLGKPGNII  180
NSGSDGGEGS SLYNHHQSAQ YNIRSSRYLV PAQELLNEFC NLGSKQHQSD QSPKAKAAAT  240
TSNQWQDHDN MNNATSSKTK SLSSLEFMEL QKRKTKLLQM LEEVDRRYKH YCDQMKAVVS  300
SFEAVAGNGA AKVYSSLASK AMSRHFRCLR DSIVSQMKTT KVAMGEKDVS APGTSRGETP  360
RLRVLDQTLR QQRAFQQMTM MDSHPWRPQR GLPERSVSVL RAWLFEHFLH PYPNDVDKHI  420
LARQTGLSRS QVSNWFINAR VRLWKPMVEE MYVEETKTNQ ETMEGTSDGF NPNPQMDQKP  480
TADELVRIDS ECLSSIINHP EKMDHHRTKT QDHDFHHSFS RVTNSFGAVE LDFSSYNNHH  540
NFGGGGDGGG GTGGVSLTLG LQQHGGGNGT GGGGGGVSLA FSPTSQNSLF YPRDHIEDCQ  600
TAVQYSSLLE GDDQGQNLPY RNLMGAQLLH DLAG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-139TALE family protein