PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024986166.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 685aa    MW: 74743.1 Da    PI: 7.199
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024986166.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094024391954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_024986166.1 402 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 439
                     554459******************************88 PP

2BELL118.92.4e-38262333172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e qe+q+kkakL+++l+eV++rY+qy++q+q+vis Fe++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  XP_024986166.1 262 EGQEIQMKKAKLVNMLDEVEQRYRQYHHQMQIVISWFEQAAGIGSAKTYTALALQTISKQFRCLKDAIMGQI 333
                     579*******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    
MATYYNGSSE IQGGDGLQTL VLMNPGYVYY SDAQQSNQPQ PGNFVFLDSN HPGNNPVNSH  60
QQQANMSHAP PPPPPPSQTQ QFVGIPLSAS PPSSVHSQHD VSSLHAFIPR AQYMYNPVEM  120
VAPPREVTPF QQGLSLSLSS QQSRYGSQAA RVASISPTAG DERRATVGGG GTTSSASGIS  180
NSVNGMHNML LNSKYLKATQ EILEEVVNVG KGVLKNSDQS TKNLTTVGSG DGGSPPPITT  240
EGLSRDETGS KSGGGAELTT AEGQEIQMKK AKLVNMLDEV EQRYRQYHHQ MQIVISWFEQ  300
AAGIGSAKTY TALALQTISK QFRCLKDAIM GQIKAASRSL GEEDSLGGGR KPDGSGSRLK  360
FVDNQLRQQR ALQQLGMIQH NAWRPQRGLP ERSVSVLRAW LFEHFLHPYP KDSDKHMLAK  420
QTGLTRSQVS NWFINARVRL WKPMVEEMYL EEIKEQEQNG LDDHKMSKSE QNEENSSSKL  480
EKSLSPENSN RRFKCTKPEN SFNHASQNIH PPSMSVSTSV STSPTAAGIN FQNPSGFSLI  540
GSLEMEGITQ FSPKKPRNSE RQQQNQDGGF SLTGNPTDFM GGLGGYPIGE IGRFSAEQFQ  600
QQYSGNGVSL TLGLPHCENL SISGTHQSFL PNQNIQLGRG TELGEDNEFG AINPPSSSHS  660
AAMYESMTIQ NRKRFAAQPL PDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-101TALE family protein