PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024985838.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 455aa    MW: 50623.8 Da    PI: 6.4084
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024985838.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.61.9e-073974302154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_024985838.1 397 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 430
                     569*****************************87 PP

2ELK28.73e-10351372122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_024985838.1 351 ELKHELKQGYKEKIVDIREEIL 372
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    
MAFHPNHLSQ EMALQQHFSD TDNNSVLRTI LPDHHHHHLA VAAQSSPSSR SVGKDHWLNS  60
AILRQQNQYG AGAADGGNNF LNLQTNNNSE SAITTSSQLH HQQHTGNNNN QWLSRSMMQR  120
NVSDVRGDDI VSQVSNDSII AAMSSHDSPD LNNQSRSVVA SQVDNNGGES EVGGGEGALV  180
NWQNARHKAE VLSHPLYEQL LSAHVACLRI ATPVDQLPRI DAQLAQSQHV VSKYSALGGH  240
ANLGDDKELD QFMTHYVLLL CSFKEQLQQH VRVHAMEAVM ACWEIEQSLQ SLTGVSPGEG  300
TGATMSDDDE DQVESDANLF DGSLDGHDSM GFGPLVPTES ERSLMERVRQ ELKHELKQGY  360
KEKIVDIREE ILRKRRAGKL PGDTTSVLKS WWQSHAKWPY PTEEDKARLV QETGLQLKQI  420
NNWFINQRKR NWHTNPSSSS SSTVLKTKRK SNAGE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0TALE family protein