PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024984814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 292aa    MW: 33441.8 Da    PI: 6.7631
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024984814.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.32.2e-072452782154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++ +L +++gL+ +q+ +WF N+R +
  XP_024984814.1 245 KWPYPTEDDKVKLVEETGLQLKQINNWFINQRKR 278
                     458*****************************87 PP

2ELK25.13.9e-09199220122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_024984814.1 199 ELKIELKQGFRSKIEDVREEIL 220
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    
MIINMQHQGL STVGTGGGFS DMVVSLSADQ HRQMKVEIAN HPLYQQLLSA HVGCLRVATP  60
IDQLPLIDSQ LSHANHLLLS YISDHHHHHH QPLSPEDRRD LDSFLAQYLV VLCAFKDRLQ  120
HHVRVDAVEA VMACREIEHN LQAITGVTLG EGTGGTMSDD EEDEMTMNFP LDQSGDVLGF  180
GPLHPTESER TLMDRVRQEL KIELKQGFRS KIEDVREEIL RKRRAGKLPG DTTSVLKDWW  240
QQHSKWPYPT EDDKVKLVEE TGLQLKQINN WFINQRKRNW NTNSNSNSKR KR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276292RKRNWNTNSNSNSKRKR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-124TALE family protein