PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024981637.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 462aa    MW: 52447.8 Da    PI: 7.9579
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024981637.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.4e-102833152254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yp+ ++++ LAk++gL+ +qV++WF N R +
  XP_024981637.1 283 HPYPTDTDKQILAKQTGLSRNQVSNWFINARVR 315
                     89*****************************88 PP

2BELL89.34.1e-29148213772
            BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +k+++L+sll+eV+krYk+y++q+q+vi sFe+v gl sa+p+++l lka+S++FrcL +ai++q+
  XP_024981637.1 148 RKRSRLISLLDEVYKRYKHYYQQIQAVITSFETVSGLSSAAPFANLDLKAMSKNFRCLNNAITDQL 213
                     799************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    
MAEGFEPYHI PQQSRREKLR VVTTGCVGDL LPLYDQSSFI SSSPNLLSKQ PRNITSSLMA  60
TATSNSDYAT AMIDESLDLQ SVNDPDNNHC YASILKGSKF LKPTQQLLDE ICDVGFGVDC  120
GLMTDPPSLE NLRTTTSVDH PNCGSDTRKR SRLISLLDEV YKRYKHYYQQ IQAVITSFET  180
VSGLSSAAPF ANLDLKAMSK NFRCLNNAIT DQLQFSVKPH EHQISYRREE LMWSGSSNDG  240
LYGQKAINNM GFVDHQPVWR PQRGLPKRAV TVLRAWLFDH FLHPYPTDTD KQILAKQTGL  300
SRNQVSNWFI NARVRLWKPM VEEVHTLEAR QVHKVSSHIQ EQETPPVISR DPSHRRNQDP  360
PSKRPRNDFS SENRYSDHHI MERNKEHMNF YGNLSIHGAN NGANGNRGVS LTLGLHQDNN  420
AITLSEPFRL NRERFVISGL DAENRQVGRE IMGGQFLHDF GG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.15e-98TALE family protein