PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024981636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 529aa    MW: 59998.3 Da    PI: 7.5723
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024981636.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.6e-103503822254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yp+ ++++ LAk++gL+ +qV++WF N R +
  XP_024981636.1 350 HPYPTDTDKQILAKQTGLSRNQVSNWFINARVR 382
                     89*****************************88 PP

2BELL894.9e-29215280772
            BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +k+++L+sll+eV+krYk+y++q+q+vi sFe+v gl sa+p+++l lka+S++FrcL +ai++q+
  XP_024981636.1 215 RKRSRLISLLDEVYKRYKHYYQQIQAVITSFETVSGLSSAAPFANLDLKAMSKNFRCLNNAITDQL 280
                     799************************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    
MAEGFEPYHI PQQSRREKLR VVTTGCVGDL LPLYDQSSFI SSSPNLLSKQ PRNITSSLMA  60
TATSNSDYAT AMIDESLDLQ SVNDPDNNHC NFLYTHQDLR FIQHHPFDGS GDFLVYKPEP  120
LALSLSSHNG THPLQKYEST GLDFCRTAVM TLGPYTGYAS ILKGSKFLKP TQQLLDEICD  180
VGFGVDCGLM TDPPSLENLR TTTSVDHPNC GSDTRKRSRL ISLLDEVYKR YKHYYQQIQA  240
VITSFETVSG LSSAAPFANL DLKAMSKNFR CLNNAITDQL QFSVKPHEHQ ISYRREELMW  300
SGSSNDGLYG QKAINNMGFV DHQPVWRPQR GLPKRAVTVL RAWLFDHFLH PYPTDTDKQI  360
LAKQTGLSRN QVSNWFINAR VRLWKPMVEE VHTLEARQVH KVSSHIQEQE TPPVISRDPS  420
HRRNQDPPSK RPRNDFSSEN RYSDHHIMER NKEHMNFYGN LSIHGANNGA NGNRGVSLTL  480
GLHQDNNAIT LSEPFRLNRE RFVISGLDAE NRQVGREIMG GQFLHDFGG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-109TALE family protein