PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024981072.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 680aa    MW: 74118.1 Da    PI: 6.8386
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024981072.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093974341954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_024981072.1 397 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 434
                     554459******************************88 PP

2BELL118.62.9e-38259330172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL+++l+eV++rY+qy++q+q+vis Fe++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  XP_024981072.1 259 ERQEVQMKKAKLVNMLDEVEQRYRQYHNQMQIVISWFEQAAGIGSAKTYTALALQTISKQFRCLKDAIMGQI 330
                     79********************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 680 aa     Download sequence    
MATYYNGNSE IQGGDGLQTL VLMNPGYVNY SDSQQPPQQQ SSQPGNFMFL NNHQHTSLSH  60
ASPPTPSQTQ QFVGIPLSAQ PPVSIHPQHD MSALHTFIPR VQYNMYNPVE MAAPPHEVTR  120
FQQGLSLSLS SQQSGFGSQA AGVPTISHTT GDDGRAPGGG GGGGGGSTPS ASGVSNGVSS  180
MQSVLLNSKY LKATQDLLEE VVNVGKGVFK NSDQSSKNLK TVGNGGGGGG GSPPATREGL  240
SGEETSAKHG DGSELTTAER QEVQMKKAKL VNMLDEVEQR YRQYHNQMQI VISWFEQAAG  300
IGSAKTYTAL ALQTISKQFR CLKDAIMGQI KTASRSLGEE DNFSGGKTDG GSRLKFVDNQ  360
IRQQRALQQL GMIQHNAWRP QRGLPERSVS VLRAWLFEHF LHPYPKDSDK HMLAKQTGLT  420
RSQVSNWFIN ARVRLWKPMV EEMYLEEIKE QEQNRSDENK MSKSEQSEEN SSSKQEKSLS  480
PENSKRGFKS NNLENSFIHA DQNNHPPPQM SVSTGVSTSP AATGINFQNP SGFTLIGSSQ  540
MEGITQFSPK KPRNSDRQQT SDVGFTLMSN PTDFMGSLGG YPIGEIGRFS AEQFQAPYSG  600
NGVSLTLGLP HCDNLSMSGS HQNFLPNQNI QLGRGVELDE SNEFEAMNQQ SSSHSAAMYE  660
TMNIQNQKRF AAQPLPDFVA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.11e-150TALE family protein