PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024979080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 370aa    MW: 40173.1 Da    PI: 6.4319
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024979080.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-093003342155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  XP_024979080.1 300 KWPYPSEAQKLALAESTGLDQKQINNWFINQRKRH 334
                     569*****************************885 PP

2ELK41.13.8e-14254275122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_024979080.1 254 ELKGQLLRKYSGYLGSLKQEFM 275
                     9********************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    
MEGGGGGGGG TSCLMSFGDN SSSNSNNNNI GSLCLPPPPV AYSNNNLIYS DHHHHHHSNC  60
GTSASALMLQ DNNNININDG GGGLGFMTSS SCSSIRAKIM SHPHYPRLLS AYLNCQKIGA  120
PPEVVGRLEE ACRASVVAAM SSCSASAGCE AGTSDGGGGG GGGGMNMMII GQDPALDQFM  180
EAYCEMLIKY EQELSKPFKE AMLFLSRVES QFKAISISTS ASGGGEGGTE KNGSSEEEVD  240
VNNNLIDPQA EDRELKGQLL RKYSGYLGSL KQEFMKKRKK GKLPKEARQQ LLDWWTRHYK  300
WPYPSEAQKL ALAESTGLDQ KQINNWFINQ RKRHWKPSED MQFVVMDAAH PPYFMENILG  360
NPYPMDVSLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1270279LKQEFMKKRK
2276280KKRKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-116TALE family protein