PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024977334.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 421aa    MW: 47269.1 Da    PI: 6.3573
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024977334.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.2e-093613981954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gL+++qV++WF N R +
  XP_024977334.1 361 FEHflHPYPNDNEKLMLASQTGLSKNQVSNWFINARVR 398
                     554459******************************88 PP

2BELL94.11.3e-30222293172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+qelq+  akL+slleeV+++Y+qy++ql+ v+ssFe  aglgs k+Yt+lAl+a+S hF  Lkdai +qi
  XP_024977334.1 222 EKQELQATLAKLISLLEEVERKYEQYYQQLEDVVSSFELNAGLGSGKSYTALALNAMSGHFSGLKDAILSQI 293
                     689*******************************************************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    
MVSPDSSSNP NSIHQFLISN PIPSQTHYES QPFDVYGVDL RSLGSYPHQS LNVLPTIQSL  60
GERMSRSIDL IQAPPMADNE QDLNQHHQNQ KLSLSLGSGL LFPSSTQYRG GRWNLISEEE  120
LREKTRKTFN PSDYCSSSSS SSLHQSSSTF YGTESISISI GSSRYLKPTQ SLLEEIVSIG  180
GKDLDSSNKS YAQKLSSSGW QGSLGLCSEL KAELCSNGLS MEKQELQATL AKLISLLEEV  240
ERKYEQYYQQ LEDVVSSFEL NAGLGSGKSY TALALNAMSG HFSGLKDAIL SQIYVTRKKI  300
LQDLPKINTG FSQLSLFDKE TNRHNRIALQ QLGMIASPRQ TWRPIRGLPE TSVMILRSWL  360
FEHFLHPYPN DNEKLMLASQ TGLSKNQVSN WFINARVRLW KPMIEEMYKE EFADSSEDSN  420
L
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.12e-95TALE family protein