PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024976429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 372aa    MW: 42223 Da    PI: 6.5123
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024976429.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-092953302055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  XP_024976429.1 295 YKWPYPSESEKVALAEATGLDQKQINNWFINQRKRH 330
                     4679*****************************885 PP

2ELK37.93.9e-13250271122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  XP_024976429.1 250 ELKNHLLRKYSGYLSSLKQELS 271
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    
MEDYMGQMRE NSSSNNTGTT SATFLYGSGG GSVLGPDATA NTSLYGRGGS SIGNESDPGG  60
YHHLQYHHHH HQHHPVVKIE TGGTQKFHNY PSVMSFHNED EALKAKIISH PHYSNLLQAY  120
MDCQKVGAPP EIVGRLTAVR QEYEARQRAN LLNSGCRDNY KDPELDQFME AYYDMLVKYK  180
EELTRPIQEA MEFMRRIESQ LSTLTISTSS TNASPDDSKC EVTGSSDEEQ ENSGGETELP  240
EIDPRAEDRE LKNHLLRKYS GYLSSLKQEL SKKKKKGKLP KEARQKLLSW WELHYKWPYP  300
SESEKVALAE ATGLDQKQIN NWFINQRKRH WKPSEDMQFM VMDGLHPQNA AAATALYMEG  360
HYMGEGPYRL GP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-134TALE family protein