PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024976428.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 379aa    MW: 42993.9 Da    PI: 6.6052
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024976428.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.4e-093023372055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+ +gL+++q+ +WF N+R ++
  XP_024976428.1 302 YKWPYPSESEKVALAEATGLDQKQINNWFINQRKRH 337
                     4679*****************************885 PP

2ELK37.83.9e-13257278122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYsgyL+sLkqE+s
  XP_024976428.1 257 ELKNHLLRKYSGYLSSLKQELS 278
                     9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    
MEDYMGQMRE NSSSNNTGTT SATFLYGSGG GSVLGPDATA NTSLYGRGGS SIGNESDPGG  60
YHHLQYHHHH HQHHPVVKIE TGGTQKFHNY PSVMSFHNED EALKAKIISH PHYSNLLQAY  120
MDCQKVGAPP EIVGRLTAVR QEYEARQRAN LLNSGCRDNY KDPELDQFME AYYDMLVKYK  180
EELTRPIQEA MEFMRRIESQ LSTLTISTSS TNASPGRIFI SPDDSKCEVT GSSDEEQENS  240
GGETELPEID PRAEDRELKN HLLRKYSGYL SSLKQELSKK KKKGKLPKEA RQKLLSWWEL  300
HYKWPYPSES EKVALAEATG LDQKQINNWF INQRKRHWKP SEDMQFMVMD GLHPQNAAAA  360
TALYMEGHYM GEGPYRLGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-134TALE family protein