PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024976353.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 318aa    MW: 36539.6 Da    PI: 5.8215
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024976353.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-092612952155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     + +yp+++++  LA+++gL+++q+ +WF N+R ++
  XP_024976353.1 261 RWPYPTEADKVALAESTGLDQKQINNWFINQRKRH 295
                     569*****************************885 PP

2ELK33.11.3e-11216236222
             ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                     LK+ LlrKYs y++sLk+EFs
  XP_024976353.1 216 LKDTLLRKYSKYISSLKHEFS 236
                     9*******************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    
MEEMYGLMNY HEQVPPPDSA RENYGHHAFD DQSPEVGHHR RIRPVFGSGS NIQTSSSNNN  60
NNGLAEELDE DLSSENRAKI MSHPLYPKLL QAYIACQKVG APPDISNLFD EIFRDNDFCR  120
RSSACSCLGD DPELDEFMET YCEMLGKYRS DLARPFDEAT TFLNNMQTQL TNLCKGTSIT  180
YHTGGDESVE RSKEDTSRGG EAEGVRSNWS NEDRALKDTL LRKYSKYISS LKHEFSNKKK  240
KGKLPKEARQ VLLDWWNLHY RWPYPTEADK VALAESTGLD QKQINNWFIN QRKRHWKPSE  300
NMQFAVMDSL CGSFIVNN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-101TALE family protein