PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_024973578.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Carduoideae; Cardueae; Carduinae; Cynara; Cynara cardunculus; Cynara cardunculus subsp. cardunculus
Family TALE
Protein Properties Length: 736aa    MW: 80153.3 Da    PI: 6.7341
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_024973578.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-094965331954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_024973578.1 496 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 533
                     664459******************************88 PP

2BELL120.85.9e-39357428172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er e+q++k+kL s+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  XP_024973578.1 357 ERIEHQRRKVKLSSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAISTQL 428
                     789******************************************************************996 PP

Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    
MSQDYIFNFS HGFERSSAQD QQQNHLGHQI RRDKLRVQGF EPPLVGLEQV DEGPGGGGGL  60
PAVYETGAGM LSEMFNFPSG GSNSASELLV NQINYQQQHR NQRPSTAGDW YGNSAQAMQL  120
FLTNPSHESP SSESPSHHHH HNNPPSSSTL HMLLPNTVPS ANSTLHHQQS FGSSTGTGQG  180
HFGPSTQFTW VPPGGTSHEG EGVGGVVDNQ GLSLSLSSTL QHLEAAKVEE LRIGDDSSAA  240
GMLYFNQVGG GDPYRNLNMQ GAGPVMGQTH HPIHIGYGSS SLGVVKVLRN SRYVKAAQEL  300
LEEFCSVGRG QFKKNKSGSK HNNPNQNPTN SGGGGGGGGG GASSSSSKDQ PPLSSTERIE  360
HQRRKVKLSS MLDEVDRRYN HYCEQMQMVV NSFDLVMGFG AAVPYTALAQ KAMSRHFRCL  420
KDAISTQLKH SCELLGEKDA GSSGVTKGET PRLKLLEQSL RQQRAFHQMG MMEQEAWRPQ  480
RGLPERSVNI LRAWLFEHFL HPYPSDADKH LLARQTGLSR NQVSNWFINA RVRLWKPMVE  540
EMYQQESKEE VDHHHHQDDD QDEENKSEGN INYNNQHKNG PASSSPSSAM AQTPMHPPPP  600
PPPATVPTYT TNSTATPAKR SEINDPENDP SILAINTQHC FSENQATTMS YSYTPTITTT  660
GNTSTIPPSF PTTHDADHTC RRGSILDAGD DAAADIGSTL IRFGTSAGDV SLTLGLRHAG  720
NLPEKTSFSV RDFGGC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-142TALE family protein